PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00020g01234.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 323aa    MW: 36227.1 Da    PI: 9.5279
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00020g01234.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-1360104147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Peaxi162Scf00020g01234.1  60 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 104
                               789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.72E-1754110IPR009057Homeodomain-like
PROSITE profilePS5129415.40855109IPR017930Myb domain
TIGRFAMsTIGR015571.4E-1858107IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-658110IPR009057Homeodomain-like
SMARTSM007175.3E-1159107IPR001005SANT/Myb domain
PfamPF002492.6E-1160104IPR001005SANT/Myb domain
CDDcd001671.94E-862105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MVSVYSTPPP GQDLYYSTTI GDPMMRMGLP GLTNNGAGIH TGLDEHNKKT RKPYTITKSR  60
ESWTEQEHDK FLEALQLFDR DWKKIEAFVG SKTVIQIRSH AQKYFLKVQK SGTSEHVPPP  120
RPKRKAAHPY PQKAPKKAVV SQVNRPFQPQ GALPELGFVI GPDSLSVPGN TINFSPWTYD  180
NVPAISTTHM RKDDTQLSSG PVTGNCSTSS NESMPSFCTT KESNDQKENK KHMKVMPDFA  240
QVYSFIGSVF DPSTRDHLGR LKQMDPIDVQ TALMLMKNLS FNLLSPEFED HRRLLSSYGL  300
GAEKDKIDSP IKTDFRENAI PTV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776267.10.0PREDICTED: protein REVEILLE 6 isoform X3
SwissprotQ8H0W38e-96RVE6_ARATH; Protein REVEILLE 6
TrEMBLJ7HBI00.0J7HBI0_CESNO; MYB
STRINGPGSC0003DMT4000005461e-176(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9982478
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-82MYB_related family protein